Host taxon 10090
Protein NP_080879.1
density-regulated protein
Mus musculus
Gene Denr, UniProt Q9CQJ6
>NP_080879.1|Pseudomona aeruginosa PA01|density-regulated protein
MATDISESSGADCKGDTKNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQETGITEGQGPVGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.52 | 0.518990074453986 | 0.039 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)