Host taxon 10090
Protein NP_001191170.1
dendritic cell inhibitory receptor 3
Mus musculus
Gene Clec4a3, UniProt Q8JZX6
>NP_001191170.1|Pseudomona aeruginosa PA01|dendritic cell inhibitory receptor 3
MFSENIYVNTNFKNKVDSSDIDTDSWPAPQRKNTSQKSCHKFSKVLFTSLIIYFLLLTILFSGALITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTFWHKGEPSSDNEQCVIINHRQSTGWGWSDIPCSDKQNSICHVKKIYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.57 | -1.56886468363169 | 0.0012 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)