Host taxon 10090
Protein NP_084526.1
dehydrodolichyl diphosphate synthase complex subunit Nus1
Mus musculus
Gene Nus1, UniProt Q99LJ8
>NP_084526.1|Pseudomona aeruginosa PA01|dehydrodolichyl diphosphate synthase complex subunit Nus1
MTGLYELVWRVLHALLCLHLTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.42 | 2.4199790588022 | 1.7e-154 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)