Host taxon 10090
Protein NP_001317067.1
death domain-containing protein CRADD
Mus musculus
Gene Cradd, UniProt O88843
>NP_001317067.1|Pseudomona aeruginosa PA01|death domain-containing protein CRADD
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEIKAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLEKAREEVTAELPTGDWMAGIPSHILSSSPSDQQINQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVHSQVVEAFVRWRQRFGKQATFLSLHKGLQAVEADPSLLQHMLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.85 | -0.849788591557051 | 0.0017 | 32071273 | |
Retrieved 1 of 3 entries in 0.5 ms
(Link to these results)