Host taxon 10090
Protein NP_665822.1
cytoplasmic phosphatidylinositol transfer protein 1 isoform 2
Mus musculus
Gene Pitpnc1, UniProt Q8K4R4
>NP_665822.1|Pseudomona aeruginosa PA01|cytoplasmic phosphatidylinositol transfer protein 1 isoform 2
MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDNHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDVREYEKNMHEQTNIKVCNQHSSTVDDIESHAQTST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.43 | -0.427561041458982 | 0.00017 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)