Host taxon 10090
Protein NP_001074575.1
cytokine-like protein 1 precursor
Mus musculus
Gene Cytl1, UniProt A1E5L0
>NP_001074575.1|Pseudomona aeruginosa PA01|cytokine-like protein 1 precursor
MSPKTLPLLLLLVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALEDPIPEATGPPDWQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.21 | -1.21092186718811 | 0.00028 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)