Bacterial taxon 208964
Protein WP_003098270.1
cytochrome c5 family protein
Pseudomona aeruginosa PA01
Gene cycB, UniProt Q9HTQ4
>WP_003098270.1|Pseudomona aeruginosa PA01|cytochrome c5 family protein
MLAAQAAVLALWAVSAQATTTDDAIAKRLEPVGKVCVQGKECEGVGAVAAAAGGGGARSGEDIVGKTCNTCHGTGLLGAPKVGDKAEWGKRAKEQGGLDGLLAKAISGINAMPPKGTCADCSDDELKAAIKHMSGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.48 | 0.483449458319922 | 2.8e-10 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)