Host taxon 10090
Protein NP_031774.2
cytochrome c oxidase subunit 6A1, mitochondrial
Mus musculus
Gene Cox6a1, UniProt P43024
>NP_031774.2|Pseudomona aeruginosa PA01|cytochrome c oxidase subunit 6A1, mitochondrial
MASAVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.33 | -0.326230434904824 | 0.046 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)