Host taxon 10090
Protein NP_001017429.1
cytochrome c oxidase copper chaperone
Mus musculus
Gene Cox17, UniProt P56394
>NP_001017429.1|Pseudomona aeruginosa PA01|cytochrome c oxidase copper chaperone
MPGLAAASPAPPEAQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.43 | 1.42995789210705 | 6.4e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)