Host taxon 10090
Protein NP_778152.1
cytochrome c oxidase assembly factor 6 homolog
Mus musculus
Gene Coa6, UniProt Q8BGD8
>NP_778152.1|Pseudomona aeruginosa PA01|cytochrome c oxidase assembly factor 6 homolog
MAAPSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLKFKEKFEAGGFQSSQSTENS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.09 | -2.0917528627543 | 0.017 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)