Host taxon 10090
Protein NP_932123.3
cytochrome c oxidase assembly factor 5
Mus musculus
Gene Coa5, UniProt Q99M07
>NP_932123.3|Pseudomona aeruginosa PA01|cytochrome c oxidase assembly factor 5
MPRYYEDKPEGGACAGVKEDLGACLLQSACVLQEGKSPRQCLKEGNCRALQYSFFECKRSMLDARSRFRGRKGY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.63 | -0.62697061272548 | 2.8e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)