Host taxon 10090
Protein NP_899093.1
cytochrome c oxidase assembly factor 4 homolog, mitochondrial
Mus musculus
Gene COA4, UniProt Q8BT51
>NP_899093.1|Pseudomona aeruginosa PA01|cytochrome c oxidase assembly factor 4 homolog, mitochondrial
MSTSVPQGHNWTRPVKKDDDEEDPLDQLITRSGCAASHFAVQECMAQHQDWRQCQPQVQAFRDCMSAQQARRREELQRRKEQASAQH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.2 | -2.20020920620093 | 0.0014 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)