Host taxon 10090
Protein NP_080894.1
cytochrome c oxidase assembly factor 3 homolog, mitochondrial
Mus musculus
Gene Coa3, UniProt Q9D2R6
>NP_080894.1|Pseudomona aeruginosa PA01|cytochrome c oxidase assembly factor 3 homolog, mitochondrial
MAAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMTGLGIGALVLAIYGYTFYSVAQERFLDELEDEAKAARARALERERASGP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.59 | -1.59441353543862 | 2.1e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)