Host taxon 10090
Protein NP_079834.2
cytochrome b5 type B precursor
Mus musculus
Gene Cyb5b, UniProt Q9CQX2
>NP_079834.2|Pseudomona aeruginosa PA01|cytochrome b5 type B precursor
MATPEASGSGEKVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAILIGFLYRHFWADSKSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.84 | -0.839593691154824 | 3.4e-23 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)