Host taxon 10090
Protein NP_080073.1
cytochrome b5 isoform 1
Mus musculus
Gene Cyb5a, UniProt P56395
>NP_080073.1|Pseudomona aeruginosa PA01|cytochrome b5 isoform 1
MAGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISALAVALMYRLYMAED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.58 | -0.577650025092002 | 3.3e-5 | 32071273 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)