Host taxon 10090
Protein NP_001313543.1
cytochrome b-c1 complex subunit 8
Mus musculus
Gene Uqcrq, UniProt Q9CQ69
>NP_001313543.1|Pseudomona aeruginosa PA01|cytochrome b-c1 complex subunit 8
MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.61 | 0.608840499869679 | 0.0067 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)