Host taxon 10090
Protein NP_079926.1
cytochrome b-c1 complex subunit 10
Mus musculus
Gene Uqcr11, UniProt Q9CPX8
>NP_079926.1|Pseudomona aeruginosa PA01|cytochrome b-c1 complex subunit 10
MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.71 | -0.710449276657664 | 0.015 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)