Host taxon 10090
Protein NP_001288213.1
cytochrome b-245 light chain isoform 2
Mus musculus
Gene Cyba, UniProt Q61462
>NP_001288213.1|Pseudomona aeruginosa PA01|cytochrome b-245 light chain isoform 2
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERWLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGPQVNPMPVTDEVV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.71 | 0.708180137022488 | 1.2e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)