Host taxon 10090
Protein NP_001268993.1
cytochrome b ascorbate-dependent protein 3 isoform 1
Mus musculus
Gene Cyb561a3, UniProt Q6P1H1
>NP_001268993.1|Pseudomona aeruginosa PA01|cytochrome b ascorbate-dependent protein 3 isoform 1
MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHDRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.74 | -1.74065473854572 | 4.1e-15 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)