Host taxon 10090
Protein NP_001334372.1
cysteine-rich protein 2 isoform 2
Mus musculus
Gene Crip2, UniProt Q9DCT8
>NP_001334372.1|Pseudomona aeruginosa PA01|cysteine-rich protein 2 isoform 2
MCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDKDPEGTVQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.13 | -3.12948159840951 | 0.0078 | 32071273 | |
Retrieved 1 of 3 entries in 2.2 ms
(Link to these results)