Host taxon 10090
Protein NP_033897.1
cysteine-rich hydrophobic domain-containing protein 1
Mus musculus
Gene Chic1, UniProt Q8CBW7
>NP_033897.1|Pseudomona aeruginosa PA01|cysteine-rich hydrophobic domain-containing protein 1
MSILLPNMAEFDTISELEEEEEAATSSSSPSSSPSSSSSSSVSGPDEDEEDEEEEEEEDEEEEDEEEEEEEVPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNSCLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLLEWENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.99 | -0.988645135738978 | 0.016 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)