Host taxon 10090
Protein NP_149026.1
cysteine dioxygenase type 1
Mus musculus
Gene Cdo1, UniProt P60334
>NP_149026.1|Pseudomona aeruginosa PA01|cysteine dioxygenase type 1
MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.83 | -0.826068667883116 | 6.5e-14 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)