Host taxon 10090
Protein NP_001263251.1
cysteine and histidine-rich protein 1 isoform 2
Mus musculus
Gene Cyhr1, UniProt Q9QXA1
>NP_001263251.1|Pseudomona aeruginosa PA01|cysteine and histidine-rich protein 1 isoform 2
MVSKPRTEWSTVLSHLVLAGVSLHAAVSSVQSSRGAAAGFLLQTFAAIIMLAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVLAVAGDHLGPEGCSVAGQAVLLVVAVTILIVAVFTANTYGMWGGTLLGVAGLLSRLEEDRLLLLPKEDVCRWALAAGSWAYCRALHTQRLQWE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.68 | -0.675225233733814 | 5.5e-9 | 32071273 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)