Host taxon 10090
Protein NP_031818.3
cysteine and glycine-rich protein 2
Mus musculus
Gene Csrp2, UniProt P97314
>NP_031818.3|Pseudomona aeruginosa PA01|cysteine and glycine-rich protein 2
MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.52 | -1.51714570272076 | 7.2e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)