Host taxon 10090
Protein NP_034106.2
cystatin-C precursor
Mus musculus
Gene Cst3, UniProt P21460
>NP_034106.2|Pseudomona aeruginosa PA01|cystatin-C precursor
MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.27 | -0.265955014247604 | 0.00011 | 32071273 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)