Host taxon 10090
Protein NP_084236.1
cystatin E2 precursor
Mus musculus
Gene Cstdc2, UniProt Q9D264
>NP_084236.1|Pseudomona aeruginosa PA01|cystatin E2 precursor
MALPWTILLALSGIYVQGAQAWCSEEDTLELDKLVSEPDIVKFALSAFHKKSKDEYAYRVIHIMNFLKVQEEPPQTFFVKLRLTRTICMKFEKSLDTCPLPELQNILICSFSISSPGSKQFNLLKMTCSEGLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.2 | -2.19799546589145 | 4.3e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)