Host taxon 10090
Protein NP_079691.1
cyclin-dependent kinases regulatory subunit 2
Mus musculus
Gene Cks2, UniProt P56390
>NP_079691.1|Pseudomona aeruginosa PA01|cyclin-dependent kinases regulatory subunit 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKEQQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.57 | 1.56658767545802 | 0.022 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)