Host taxon 10090
Protein NP_034005.2
cyclin-dependent kinase inhibitor 1B
Mus musculus
Gene Cdkn1b, UniProt P46414
>NP_034005.2|Pseudomona aeruginosa PA01|cyclin-dependent kinase inhibitor 1B
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.86 | -0.856365024550693 | 2.2e-7 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)