Host taxon 10090
Protein NP_034008.2
cyclin-dependent kinase 4 inhibitor D
Mus musculus
Gene Cdkn2d, UniProt Q60773
>NP_034008.2|Pseudomona aeruginosa PA01|cyclin-dependent kinase 4 inhibitor D
MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.64 | 2.63567001371256 | 8.8e-38 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)