Host taxon 10090
Protein NP_001288297.1
cyclin-dependent kinase 4 inhibitor C
Mus musculus
Gene Cdkn2c, UniProt Q60772
>NP_001288297.1|Pseudomona aeruginosa PA01|cyclin-dependent kinase 4 inhibitor C
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPNLKDGTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVEFLMKHTACNVGHRNHKGDTAFDLARFYGRNEVISLMEANGVGGATSLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.98 | -1.97795446952625 | 1.3e-7 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)