Host taxon 10090
Protein NP_031696.1
cyclin-dependent kinase 4 inhibitor B
Mus musculus
Gene Cdkn2b, UniProt P55271
>NP_031696.1|Pseudomona aeruginosa PA01|cyclin-dependent kinase 4 inhibitor B
MLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDIARYLHAATGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.33 | 0.326918790285729 | 0.049 | 32071273 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)