Host taxon 10090
Protein NP_038840.2
cyclin-dependent kinase 2-associated protein 1
Mus musculus
Gene Cdk2ap1, UniProt O35207
>NP_038840.2|Pseudomona aeruginosa PA01|cyclin-dependent kinase 2-associated protein 1
MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.61 | -1.60961102065881 | 0.0016 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)