Bacterial taxon 208964
Protein WP_003113684.1
cyanide-forming glycine dehydrogenase subunit HcnA
Pseudomona aeruginosa PA01
Gene hcnA, UniProt G3XD67
>WP_003113684.1|Pseudomona aeruginosa PA01|cyanide-forming glycine dehydrogenase subunit HcnA
MHLLERQHDIQPLSRADMTIHLNGQPVAAAAGETVLNVLNAVGLRRLARNDHGQASGAFCGMGVCHCCLVAIDGRPKRRACQTVVRPGMRVETESNRFDQEERP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.57 | -1.56797628047331 | 1.0e-5 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)