Host taxon 10090
Protein NP_033290.1
cornifin-A
Mus musculus
Gene Sprr1a, UniProt Q62266
>NP_033290.1|Pseudomona aeruginosa PA01|cornifin-A
MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPEPCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.33 | 3.33146635067264 | 0.00017 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)