Host taxon 10090
Protein NP_001191058.1
complement C1q tumor necrosis factor-related protein 1 precursor
Mus musculus
Gene C1qtnf1, UniProt Q9QXP7
>NP_001191058.1|Pseudomona aeruginosa PA01|complement C1q tumor necrosis factor-related protein 1 precursor
MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTRPEETREKYSPRQGEDLPTSRCYRCCDPSTPVYQTIPPPQINITILKGEKGDRGDRGLQGKYGKIGSTGPRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNMFTGKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMELREEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.74 | 0.743397572183126 | 0.003 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)