Host taxon 10090
Protein NP_001028304.1
COMM domain-containing protein 6 isoform 1
Mus musculus
Gene Commd6, UniProt Q3V4B5
>NP_001028304.1|Pseudomona aeruginosa PA01|COMM domain-containing protein 6 isoform 1
MEESGFREPVLDAKSEVTGQLIDFQWKLGMAVSSDSCRSLKYPYVAVMLKVADHSGQVSSKSIEMTIPQFQNFYKQFKEIAAVIETV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.79 | -1.79356452166735 | 2.3e-5 | 32071273 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)