Host taxon 10090
Protein NP_079812.1
COMM domain-containing protein 5
Mus musculus
Gene Commd5, UniProt Q8R395
>NP_079812.1|Pseudomona aeruginosa PA01|COMM domain-containing protein 5
MSALGAAAPYLHHPTDSHSGRVSFLGSQPSAEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVQHLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDSVAQQQGSSLPRVSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELERKCERKLQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.17 | -2.16798758690752 | 6.4e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)