Bacterial taxon 208964
Protein WP_003090435.1
cold shock domain-containing protein CspD
Pseudomona aeruginosa PA01
Gene cspD, UniProt Q9I0L6
>WP_003090435.1|Pseudomona aeruginosa PA01|cold shock domain-containing protein CspD
MLSGKVKWFNNAKGYGFILAEGRDEDLFAHYSAIQMDGYKTLKAGQPVNFEIIQGPKGLHAINISPATATTAAPSAPAPQEEPQATPIEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.94 | -3.94373644231317 | 7.4e-228 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)