Host taxon 10090
Protein NP_079671.1
coiled-coil-helix-coiled-coil-helix domain-containing protein 5
Mus musculus
Gene Chchd5, UniProt Q9CQP3
>NP_079671.1|Pseudomona aeruginosa PA01|coiled-coil-helix-coiled-coil-helix domain-containing protein 5
MQAALEVTARYCSRELDQYGQCVAAKPESWHRDCHHLKMSIARCTSSHPIIRQIRQACAEPFEAFEKCLRLNEAAVGNCAEHMRRFLQCAEQVQPPSSPTTGEAQPLPAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.65 | -1.65119019636847 | 0.002 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)