Host taxon 10090
Protein NP_780538.2
coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
Mus musculus
Gene Chchd10, UniProt Q7TNL9
>NP_780538.2|Pseudomona aeruginosa PA01|coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial
MPRGSRSAAARPVSRPAPPPAHPPPSAAAPAPAAPGQPGLMAQMASTAAGVAVGSAVGHVMGSALTSAFSGGNSEPAQPAVQQAPARPASHPLQMGPCSYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGLSSLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.97 | -0.96713430493657 | 0.00012 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)