Host taxon 10090
Protein NP_001313517.1
coiled-coil domain-containing protein 134 isoform 2
Mus musculus
Gene Ccdc134, UniProt Q8C7V8
>NP_001313517.1|Pseudomona aeruginosa PA01|coiled-coil domain-containing protein 134 isoform 2
MFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLIAADVLPDGPVPQDEKLKDAFSHVVENTAFFGDVVLRFPKIVHHYFDHNSNWNLLIRWGISFCNQTGVFDQGPHSPILSLMAQELGITEKDSDFRNPFKTDQTEFIPSTDPFQKALREEEKRRKKEERRKEIRKGPRISRSQSEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.12 | -1.11697987831207 | 0.004 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)