Host taxon 10090
Protein NP_001298041.1
coiled-coil domain-containing protein 126 isoform 2 precursor
Mus musculus
Gene Ccdc126, UniProt Q8BIS8
>NP_001298041.1|Pseudomona aeruginosa PA01|coiled-coil domain-containing protein 126 isoform 2 precursor
MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKLREQILDLSKRYVKALAEESRSTADVDSGASMAGYVLHLPGPASLYLLSNSASQEMTHC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.32 | -1.3192978009762 | 9.1e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)