Host taxon 10090
Protein NP_031714.1
cofilin-2
Mus musculus
Gene Cfl2, UniProt P45591
>NP_031714.1|Pseudomona aeruginosa PA01|cofilin-2
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSVVVSLEGKPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.44 | -0.441574623336911 | 0.026 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)