Bacterial taxon 208964
Protein WP_003094153.1
ClpXP protease specificity-enhancing factor
Pseudomona aeruginosa PA01
Gene sspB, UniProt Q9HVY8
>WP_003094153.1|Pseudomona aeruginosa PA01|ClpXP protease specificity-enhancing factor
MNSSRPYLVRALYEWIVDNDCTPHILVNAEFAGVKVPPGYASDGQIVLNVSPSAVRHLHMDNEAVSFEGRFGGVAQSLYIPALAVMAIYARENGQGMVFDLEQPGPVDDEPGDDDGGPSDEPPRPSGRPSLKVVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.29 | 1.29268494431365 | 2.2e-38 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)