Host taxon 10090
Protein NP_741968.1
claudin domain-containing protein 1 isoform 1
Mus musculus
Gene Cldnd1, UniProt Q9CQX5
>NP_741968.1|Pseudomona aeruginosa PA01|claudin domain-containing protein 1 isoform 1
MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.05 | 1.04706576157558 | 1.6e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)