Host taxon 10090
Protein NP_081570.1
CKLF-like MARVEL transmembrane domain-containing protein 8
Mus musculus
Gene Cmtm8, UniProt Q9CZR4
>NP_081570.1|Pseudomona aeruginosa PA01|CKLF-like MARVEL transmembrane domain-containing protein 8
MEEQQRARSHTVTTTTSSFAENFSTTSSSFAYDREFLRTPPGLLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIVYITLTYTRIPQVPWTTVGLCFNGSAFVLYFSAAIVDASSVSPEKEGHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTAQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.01 | -1.00581618134837 | 0.0015 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)