Host taxon 10090
Protein NP_080312.1
CKLF-like MARVEL transmembrane domain-containing protein 6
Mus musculus
Gene Cmtm6, UniProt Q9CZ69
>NP_080312.1|Pseudomona aeruginosa PA01|CKLF-like MARVEL transmembrane domain-containing protein 6
MENGAVYSPTTEAAPGTGRGARSGLAAYFVLGRLPWHRRILKGLQLLLSLLAFICEEVVSECGLCGGLYFFEFVSCSAFLLSLLLLIVYCTPVHDRVDTGKVKSSDFYITLGTGCVFLLASIIFVSTHSGTSAEIAAIVFGFLASSMFLLDFVVMLCEKLRESPLRKPENNAKVEALTEPLNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.82 | 0.816279615411112 | 2.5e-22 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)