Host taxon 10090
Protein NP_705810.2
CKLF-like MARVEL transmembrane domain-containing protein 4
Mus musculus
Gene Cmtm4, UniProt Q8CJ61
>NP_705810.2|Pseudomona aeruginosa PA01|CKLF-like MARVEL transmembrane domain-containing protein 4
MRGGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMECSPCEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRIPQINWNLTDLVNTGLSTFFFFIASIVLAALNHKTGAEIAAVIFGFLATAAYAVSTFLAMQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.28 | -0.28211013367567 | 0.011 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)