Host taxon 10090
Protein NP_080707.2
cilia- and flagella-associated protein 410
Mus musculus
Gene Cfap410, UniProt Q8C6G1
>NP_080707.2|Pseudomona aeruginosa PA01|cilia- and flagella-associated protein 410
MKLTRKMVLSRAKASELHNVRKLNCWGSQLTDISICREMPSLEVITLSVNSVSTLEPVRSCRRLSELYLRRNRIPSLNELFYLKDLPHLRVLWLAENPCCGTSPHLYRMTVLRNLPHLQKLDNQAVTEEELTRALMEGDEITAAPHREGAGNGCPKPPYALNSVSSATETSQHLLSYTEETEVQGQTTTDQSPSFSPRDTMRSHKNRNILTAILLLLRELDTEGLETVQQTVGSRLQALHRPEPQEDME
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.14 | -1.1409315665609 | 0.017 | 32071273 | |
Retrieved 1 of 3 entries in 2.1 ms
(Link to these results)