Host taxon 10090
Protein NP_032213.2
cilia- and flagella-associated protein 20
Mus musculus
Gene Cfap20, UniProt Q8BTU1
>NP_032213.2|Pseudomona aeruginosa PA01|cilia- and flagella-associated protein 20
MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.78 | -1.77680339906498 | 6.2e-9 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)